RHOBTB1 antibody (Middle Region)

Catalog No. ABIN634415

The Rabbit Polyclonal anti-RHOBTB1 antibody has been validated for WB and IHC. It is suitable to detect RHOBTB1 in samples from Human, Mouse, Dog and Rat.

Quick Overview for RHOBTB1 antibody (Middle Region) (ABIN634415)

Target: RHOBTB1 (rho-Related BTB Domain Containing 1 (RHOBTB1))

Reactivity: Human, Mouse, Dog, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RHOBTB1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-RHOBTB1 Antibody

Binding Specificity: Middle Region

Specificity: RHOBTB1 antibody was raised against the middle region of RHOBTB1

Purification: Affinity purified

Immunogen: RHOBTB1 antibody was raised using the middle region of RHOBTB1 corresponding to a region with amino acids DNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWN

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RHOBTB1 Blocking Peptide, (ABIN937473), is also available for use as a blocking control in assays to test for specificity of this RHOBTB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOBTB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RHOBTB1

Target: RHOBTB1 (rho-Related BTB Domain Containing 1 (RHOBTB1))

Alternative Name: RHOBTB1

Background: RHOBTB1 belongs to the Rho family of the small GTPase superfamily. It contains a GTPase domain, a proline-rich region, a tandem of 2 BTB (broad complex, tramtrack, and bric-a-brac) domains, and a conserved C-terminal region. The protein plays a role in small GTPase-mediated signal transduction and the organization of the actin filament system.

Molecular Weight: 77 kDa (MW of target protein)