SAMHD1 antibody (Middle Region)

Catalog No. ABIN634417

Product Details anti-SAMHD1 Antibody

Target: SAMHD1 (SAM Domain and HD Domain 1 (SAMHD1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SAMHD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SAMHD1 antibody was raised against the middle region of SAMHD1

Purification: Affinity purified

Immunogen: SAMHD1 antibody was raised using the middle region of SAMHD1 corresponding to a region with amino acids KGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SAMHD1 Blocking Peptide, catalog no. 33R-4405, is also available for use as a blocking control in assays to test for specificity of this SAMHD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAMHD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SAMHD1

Target: SAMHD1 (SAM Domain and HD Domain 1 (SAMHD1))

Alternative Name: SAMHD1 (SAMHD1 Products)

Synonyms: CHBL2 antibody, DCIP antibody, HDDC1 antibody, MOP-5 antibody, SBBI88 antibody, si:dkeyp-44b8.8 antibody, E330031J07Rik antibody, Mg11 antibody, SAM and HD domain containing deoxynucleoside triphosphate triphosphohydrolase 1 antibody, SAM domain and HD domain 1 antibody, SAM domain and HD domain, 1 antibody, SAMHD1 antibody, samhd1 antibody, Samhd1 antibody

Background: SAMHD1 contains 1 HD domain and 1 SAM (sterile alpha motif) domain. SAMHD1 may play a role in mediating proinflammatory responses to TNF-alpha signaling.

Molecular Weight: 72 kDa (MW of target protein)