RASL10A antibody (N-Term)

Catalog No. ABIN634426

This Rabbit Polyclonal antibody specifically detects RASL10A in WB. It exhibits reactivity toward Human.

Quick Overview for RASL10A antibody (N-Term) (ABIN634426)

Target: RASL10A (RAS-Like, Family 10, Member A (RASL10A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RASL10A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RASL10A Antibody

Binding Specificity: N-Term

Specificity: RASL10 A antibody was raised against the N terminal of RASL10

Purification: Affinity purified

Immunogen: RASL10 A antibody was raised using the N terminal of RASL10 corresponding to a region with amino acids PTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPGGPEEWPDAKDWSLQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RASL10A Blocking Peptide, (ABIN5615769), is also available for use as a blocking control in assays to test for specificity of this RASL10A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASL10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RASL10A

Target: RASL10A (RAS-Like, Family 10, Member A (RASL10A))

Alternative Name: RASL10A

Background: The specific function of RASL10A is not yet known.

Molecular Weight: 22 kDa (MW of target protein)