Calcyphosine antibody (N-Term)

Catalog No. ABIN634437

This anti-Calcyphosine antibody is a Rabbit Polyclonal antibody detecting Calcyphosine in WB. Suitable for Human.

Quick Overview for Calcyphosine antibody (N-Term) (ABIN634437)

Target: Calcyphosine (CAPS)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Calcyphosine antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Calcyphosine Antibody

Binding Specificity: N-Term

Specificity: CAPS antibody was raised against the N terminal of CAPS

Purification: Affinity purified

Immunogen: CAPS antibody was raised using the N terminal of CAPS corresponding to a region with amino acids DAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CAPS Blocking Peptide, (ABIN937250), is also available for use as a blocking control in assays to test for specificity of this CAPS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAPS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Calcyphosine

Target: Calcyphosine (CAPS)

Alternative Name: CAPS

Background: CAPS is a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit.

Molecular Weight: 21 kDa (MW of target protein)