TBL3 antibody

Catalog No. ABIN634442

The Rabbit Polyclonal anti-TBL3 antibody is suitable to detect TBL3 in samples from Human. It has been validated for WB.

Quick Overview for TBL3 antibody (ABIN634442)

Target: TBL3 (Transducin (Beta)-Like 3 (TBL3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TBL3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TBL3 Antibody

Purification: Affinity purified

Immunogen: TBL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAETAAGVGRFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCGTRVNIL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TBL3 Blocking Peptide, (ABIN5616523), is also available for use as a blocking control in assays to test for specificity of this TBL3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TBL3

Target: TBL3 (Transducin (Beta)-Like 3 (TBL3))

Alternative Name: TBL3

Background: The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function.

Molecular Weight: 89 kDa (MW of target protein)