RBM9 antibody (Middle Region)

Catalog No. ABIN634463

The Rabbit Polyclonal anti-RBM9 antibody has been validated for WB. It is suitable to detect RBM9 in samples from Human.

Quick Overview for RBM9 antibody (Middle Region) (ABIN634463)

Target: RBM9 (RNA Binding Motif Protein 9 (RBM9))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBM9 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RBM9 Antibody

Binding Specificity: Middle Region

Specificity: RBM9 antibody was raised against the middle region of RBM9

Purification: Affinity purified

Immunogen: RBM9 antibody was raised using the middle region of RBM9 corresponding to a region with amino acids PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBM9 Blocking Peptide, (ABIN5615798), is also available for use as a blocking control in assays to test for specificity of this RBM9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBM9

Target: RBM9 (RNA Binding Motif Protein 9 (RBM9))

Alternative Name: RBM9

Background: RBM9 is a RNA-binding protein that seems to act as a coregulatory factor of ER-alpha.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Skeletal Muscle Fiber Development