VPREB1 antibody (Middle Region)

Catalog No. ABIN634478

The Rabbit Polyclonal anti-VPREB1 antibody has been validated for WB. It is suitable to detect VPREB1 in samples from Human and Mouse.

Quick Overview for VPREB1 antibody (Middle Region) (ABIN634478)

Target: VPREB1 (Pre-B Lymphocyte 1 (VPREB1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VPREB1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-VPREB1 Antibody

Binding Specificity: Middle Region

Specificity: VPREB1 antibody was raised against the middle region of VPREB1

Purification: Affinity purified

Immunogen: VPREB1 antibody was raised using the middle region of VPREB1 corresponding to a region with amino acids TIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VPREB1 Blocking Peptide, (ABIN5616972), is also available for use as a blocking control in assays to test for specificity of this VPREB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPREB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VPREB1

Target: VPREB1 (Pre-B Lymphocyte 1 (VPREB1))

Alternative Name: VPREB1

Background: VPREB1 belongs to the immunoglobulin superfamily and is expressed selectively at the early stages of B cell development, namely, in proB and early preB cells.

Molecular Weight: 16 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response, Regulation of Cell Size