IL-15 antibody (N-Term)

Catalog No. ABIN634483

This Rabbit Polyclonal antibody specifically detects IL-15 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for IL-15 antibody (N-Term) (ABIN634483)

Target: IL-15 (IL15) (Interleukin 15 (IL15))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IL-15 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IL-15 Antibody

Binding Specificity: N-Term

Specificity: IL15 antibody was raised against the N terminal of IL15

Purification: Affinity purified

Immunogen: IL15 antibody was raised using the N terminal of IL15 corresponding to a region with amino acids RISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IL15 Blocking Peptide, (ABIN5614168), is also available for use as a blocking control in assays to test for specificity of this IL15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IL-15

Target: IL-15 (IL15) (Interleukin 15 (IL15))

Alternative Name: IL15

Background: IL15 is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other's activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis.

Molecular Weight: 13 kDa (MW of target protein)

Pathways: JAK-STAT Signaling, Glycosaminoglycan Metabolic Process