SFTPD antibody (Middle Region)

Catalog No. ABIN634484

Product Details anti-SFTPD Antibody

Target: SFTPD (Surfactant Protein D (SFTPD))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SFTPD antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SFTPD antibody was raised against the middle region of SFTPD

Purification: Affinity purified

Immunogen: SFTPD antibody was raised using the middle region of SFTPD corresponding to a region with amino acids PPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SFTPD Blocking Peptide, catalog no. 33R-7253, is also available for use as a blocking control in assays to test for specificity of this SFTPD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFTPD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SFTPD

Target: SFTPD (Surfactant Protein D (SFTPD))

Alternative Name: SFTPD (SFTPD Products)

Synonyms: COLEC7 antibody, PSP-D antibody, SFTP4 antibody, SP-D antibody, BDE antibody, BDSD antibody, HOX4I antibody, SPD antibody, AI573415 antibody, Sftp4 antibody, surfactant protein D antibody, homeobox D13 antibody, surfactant associated protein D antibody, SFTPD antibody, HOXD13 antibody, Sftpd antibody, SP-D antibody

Background: SFTPD contributes to the lung's defense against inhaled microorganisms. SFTPD may participate in the extracellular reorganization or turnover of pulmonary surfactant.

Molecular Weight: 35 kDa (MW of target protein)