SAA4 antibody (Middle Region)

Catalog No. ABIN634497

Product Details anti-SAA4 Antibody

Target: SAA4 (Serum Amyloid A 4 (SAA4))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SAA4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SAA4 antibody was raised against the middle region of SAA4

Purification: Affinity purified

Immunogen: SAA4 antibody was raised using the middle region of SAA4 corresponding to a region with amino acids AAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SAA4 Blocking Peptide, catalog no. 33R-1030, is also available for use as a blocking control in assays to test for specificity of this SAA4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SAA4

Target: SAA4 (Serum Amyloid A 4 (SAA4))

Alternative Name: SAA4 (SAA4 Products)

Synonyms: C-SAA antibody, CSAA antibody, serum amyloid A4, constitutive antibody, SAA4 antibody

Background: SAA4 is a major acute phase reactant. It is an Apolipoprotein of the HDL complex.

Molecular Weight: 2 kDa (MW of target protein)