TRAF7 antibody (N-Term)

Catalog No. ABIN634504

This Rabbit Polyclonal antibody specifically detects TRAF7 in WB. It exhibits reactivity toward Human and Rat.

Quick Overview for TRAF7 antibody (N-Term) (ABIN634504)

Target: TRAF7 (TNF Receptor-Associated Factor 7 (TRAF7))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRAF7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TRAF7 Antibody

Binding Specificity: N-Term

Specificity: TRAF7 antibody was raised against the N terminal of TRAF7

Purification: Affinity purified

Immunogen: TRAF7 antibody was raised using the N terminal of TRAF7 corresponding to a region with amino acids GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEEDSMPPISTPR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRAF7 Blocking Peptide, (ABIN938848), is also available for use as a blocking control in assays to test for specificity of this TRAF7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAF7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRAF7

Target: TRAF7 (TNF Receptor-Associated Factor 7 (TRAF7))

Alternative Name: TRAF7

Background: Tumor necrosis factor (TNF) receptor-associated factors, such as TRAF7, are signal transducers for members of the TNF receptor superfamily.

Molecular Weight: 74 kDa (MW of target protein)