Myxovirus (C-Term) antibody

Catalog No. ABIN634510

This Rabbit Polyclonal antibody specifically detects in WB. It exhibits reactivity toward Virus.

Quick Overview for Myxovirus (C-Term) antibody (ABIN634510)

Target: Myxovirus

Reactivity: Virus

Host: Rabbit

Clonality: Polyclonal

Application: Western Blotting (WB)

Product Details

Binding Specificity: C-Term

Specificity: Myxovirus antibody was raised against the C terminal of MX1

Cross-Reactivity: Human, Dog (Canine)

Purification: Affinity purified

Immunogen: Myxovirus antibody was raised using the C terminal of MX1 corresponding to a region with amino acids KAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQFPG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Myxovirus Blocking Peptide, (ABIN939636), is also available for use as a blocking control in assays to test for specificity of this Myxovirus antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Myxovirus

Target Type: Virus

Background: In mouse, the interferon-inducible Mx protein is responsible for a specific antiviral state against influenza virus infection. MX1 is similar to the mouse protein as determined by its antigenic relatedness, induction conditions, physicochemical properties, and amino acid analysis. This cytoplasmic protein is a member of both the dynamin family and the family of large GTPases. In mouse, the interferon-inducible Mx protein is responsible for a specific antiviral state against influenza virus infection.

Molecular Weight: 75 kDa (MW of target protein)