-
- Target
- Myxovirus
- Binding Specificity
- C-Term
- Reactivity
- Virus
- Host
- Rabbit
- Clonality
- Polyclonal
- Application
- Western Blotting (WB)
- Specificity
- Myxovirus antibody was raised against the C terminal of MX1
- Cross-Reactivity
- Human, Dog (Canine)
- Purification
- Affinity purified
- Immunogen
- Myxovirus antibody was raised using the C terminal of MX1 corresponding to a region with amino acids KAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQFPG
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Myxovirus Blocking Peptide, catalog no. 33R-4250, is also available for use as a blocking control in assays to test for specificity of this Myxovirus antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MX1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Myxovirus
- Target Type
- Virus
- Background
- In mouse, the interferon-inducible Mx protein is responsible for a specific antiviral state against influenza virus infection. MX1 is similar to the mouse protein as determined by its antigenic relatedness, induction conditions, physicochemical properties, and amino acid analysis. This cytoplasmic protein is a member of both the dynamin family and the family of large GTPases. In mouse, the interferon-inducible Mx protein is responsible for a specific antiviral state against influenza virus infection.
- Molecular Weight
- 75 kDa (MW of target protein)
-
You are here:
