NMBR antibody (N-Term)
-
- Target See all NMBR Antibodies
- NMBR (Neuromedin B Receptor (NMBR))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NMBR antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NMBR antibody was raised against the N terminal of NMBR
- Purification
- Affinity purified
- Immunogen
- NMBR antibody was raised using the N terminal of NMBR corresponding to a region with amino acids PSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYL
- Top Product
- Discover our top product NMBR Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NMBR Blocking Peptide, catalog no. 33R-7356, is also available for use as a blocking control in assays to test for specificity of this NMBR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NMBR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NMBR (Neuromedin B Receptor (NMBR))
- Alternative Name
- NMBR (NMBR Products)
- Synonyms
- NMBR antibody, si:dkey-283f18.1 antibody, BB182387 antibody, NMB-R antibody, neuromedin B receptor antibody, NMBR antibody, nmbr antibody, Nmbr antibody
- Background
- Neuromedin B receptor binds neuromedin B, a potent mitogen and growth factor for normal and neoplastic lung and for gastrointestinal epithelial tissue.
- Molecular Weight
- 43 kDa (MW of target protein)
-