ATP2C1 antibody (C-Term)
-
- Target See all ATP2C1 Antibodies
- ATP2C1 (ATPase, Ca++ Transporting, Type 2C, Member 1 (ATP2C1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ATP2C1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ATP2 C1 antibody was raised against the C terminal of ATP2 1
- Purification
- Affinity purified
- Immunogen
- ATP2 C1 antibody was raised using the C terminal of ATP2 1 corresponding to a region with amino acids TKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILGLA
- Top Product
- Discover our top product ATP2C1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ATP2C1 Blocking Peptide, catalog no. 33R-9151, is also available for use as a blocking control in assays to test for specificity of this ATP2C1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP2C1 (ATPase, Ca++ Transporting, Type 2C, Member 1 (ATP2C1))
- Alternative Name
- ATP2C1 (ATP2C1 Products)
- Background
- ATP2C1 belongs to the family of P-type cation transport ATPases. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Defects in this gene cause Hailey-Hailey disease, an autosomal dominant disorder. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Molecular Weight
- 98 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis, Ribonucleoside Biosynthetic Process
-