KLRF1 antibody (Middle Region)
-
- Target See all KLRF1 Antibodies
- KLRF1 (Killer Cell Lectin-Like Receptor Subfamily F, Member 1 (KLRF1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KLRF1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KLRF1 antibody was raised against the middle region of KLRF1
- Purification
- Affinity purified
- Immunogen
- KLRF1 antibody was raised using the middle region of KLRF1 corresponding to a region with amino acids QKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLK
- Top Product
- Discover our top product KLRF1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KLRF1 Blocking Peptide, catalog no. 33R-7602, is also available for use as a blocking control in assays to test for specificity of this KLRF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLRF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KLRF1 (Killer Cell Lectin-Like Receptor Subfamily F, Member 1 (KLRF1))
- Alternative Name
- KLRF1 (KLRF1 Products)
- Background
- KLRF1, an activating homodimeric C-type lectin-like receptor (CTLR), is expressed on nearly all natural killer (NK) cells and stimulates their cytoxicity and cytokine release.
- Molecular Weight
- 26 kDa (MW of target protein)
-