ADAM33 antibody (Middle Region)

Catalog No. ABIN634549

This Rabbit Polyclonal antibody specifically detects ADAM33 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for ADAM33 antibody (Middle Region) (ABIN634549)

Target: ADAM33 (ADAM Metallopeptidase Domain 33 (ADAM33))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADAM33 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ADAM33 Antibody

Binding Specificity: Middle Region

Specificity: ADAM33 antibody was raised against the middle region of ADAM33

Purification: Affinity purified

Immunogen: ADAM33 antibody was raised using the middle region of ADAM33 corresponding to a region with amino acids HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADAM33 Blocking Peptide, (ABIN939097), is also available for use as a blocking control in assays to test for specificity of this ADAM33 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADAM33

Target: ADAM33 (ADAM Metallopeptidase Domain 33 (ADAM33))

Alternative Name: ADAM33

Background: ADAM33 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM33 is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness.

Molecular Weight: 62 kDa (MW of target protein)