Tetraspanin 6 antibody (N-Term)

Catalog No. ABIN634550

The Rabbit Polyclonal anti-Tetraspanin 6 antibody has been validated for WB. It is suitable to detect Tetraspanin 6 in samples from Human, Mouse and Rat.

Quick Overview for Tetraspanin 6 antibody (N-Term) (ABIN634550)

Target: Tetraspanin 6 (TSPAN6)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Tetraspanin 6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Tetraspanin 6 Antibody

Binding Specificity: N-Term

Specificity: Tetraspanin 6 antibody was raised against the N terminal of TSPAN6

Purification: Affinity purified

Immunogen: Tetraspanin 6 antibody was raised using the N terminal of TSPAN6 corresponding to a region with amino acids VGIWGKVSLENYFSLLNEKATNVPFVLIATGTVIILLGTFGCFATCRASA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tetraspanin 6 Blocking Peptide, (ABIN5616559), is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Tetraspanin 6

Target: Tetraspanin 6 (TSPAN6)

Alternative Name: Tetraspanin 6

Background: TSPAN6 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein and is highly similar in sequence to the transmembrane 4 superfamily member 2.

Molecular Weight: 27 kDa (MW of target protein)