C1QB antibody (C-Term)
-
- Target See all C1QB Antibodies
- C1QB (Complement Component 1, Q Subcomponent, B Chain (C1QB))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C1QB antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- C1 QB antibody was raised against the C terminal of C1 B
- Purification
- Affinity purified
- Immunogen
- C1 QB antibody was raised using the C terminal of C1 B corresponding to a region with amino acids AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD
- Top Product
- Discover our top product C1QB Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C1QB Blocking Peptide, catalog no. 33R-1631, is also available for use as a blocking control in assays to test for specificity of this C1QB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 B antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C1QB (Complement Component 1, Q Subcomponent, B Chain (C1QB))
- Alternative Name
- C1QB (C1QB Products)
- Synonyms
- complement C1q B chain antibody, complement component 1, q subcomponent, beta polypeptide antibody, C1QB antibody, C1qb antibody
- Background
- C1QB is a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. C1QB is the B-chain polypeptide of human complement subcomponent C1q.
- Molecular Weight
- 27 kDa (MW of target protein)
- Pathways
- Complement System
-