IL-22 antibody (C-Term)

Catalog No. ABIN634575

This anti-IL-22 antibody is a Rabbit Polyclonal antibody detecting IL-22 in WB. Suitable for Human and Mouse.

Quick Overview for IL-22 antibody (C-Term) (ABIN634575)

Target: IL-22 (IL22) (Interleukin 22 (IL22))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IL-22 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IL-22 Antibody

Binding Specificity: C-Term

Specificity: IL22 antibody was raised against the C terminal of IL22

Purification: Affinity purified

Immunogen: IL22 antibody was raised using the C terminal of IL22 corresponding to a region with amino acids CHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IL22 Blocking Peptide, (ABIN937095), is also available for use as a blocking control in assays to test for specificity of this IL22 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IL-22

Target: IL-22 (IL22) (Interleukin 22 (IL22))

Alternative Name: IL22

Background: IL22 belongs to the IL-10 family. It is a cytokine that contributes to the inflammatory response in vivo.

Molecular Weight: 20 kDa (MW of target protein)