Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

GHRHR antibody (Growth Hormone Releasing Hormone Receptor) (N-Term) Primary Antibody

GHRHR Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN634579
$672.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    GHRHR
    Binding Specificity
    • 15
    • 9
    • 4
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    N-Term
    Reactivity
    • 57
    • 27
    • 26
    • 6
    • 5
    • 5
    • 5
    • 4
    • 4
    • 4
    • 4
    Human
    Host
    • 57
    Rabbit
    Clonality
    • 57
    Polyclonal
    Conjugate
    • 26
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    This GHRHR antibody is un-conjugated
    Application
    • 26
    • 21
    • 13
    • 12
    • 11
    • 8
    • 5
    • 4
    • 3
    • 1
    • 1
    Western Blotting (WB)
    Specificity
    GHRHR antibody was raised against the N terminal of GHRHR
    Purification
    Affinity purified
    Immunogen
    GHRHR antibody was raised using the N terminal of GHRHR corresponding to a region with amino acids VTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEE
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    GHRHR Blocking Peptide, catalog no. 33R-9852, is also available for use as a blocking control in assays to test for specificity of this GHRHR antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GHRHR antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    GHRHR
    Alternative Name
    GHRHR (GHRHR Antibody Abstract)
    Synonyms
    GHRFR, GRFR, IGHD1B, Ghrfr, lit, little, GHRHREC, GHRH-R, growth hormone releasing hormone receptor, GHRHR, Ghrhr
    Background
    GHRHR is a receptor for growth hormone-releasing hormone. Binding of this hormone to the receptor leads to synthesis and release of growth hormone. Mutations in its gene have been associated with isolated growth hormone deficiency (IGHD), also known as Dwarfism of Sindh, a disorder characterized by short stature.
    Molecular Weight
    47 kDa (MW of target protein)
    Pathways
    Intracellular Steroid Hormone Receptor Signaling Pathway, Hormone Transport, Regulation of Intracellular Steroid Hormone Receptor Signaling, cAMP Metabolic Process
You are here:
help Support