BCAP31 antibody (Middle Region)

Catalog No. ABIN634582

This Rabbit Polyclonal antibody specifically detects BCAP31 in WB. It exhibits reactivity toward Human.

Quick Overview for BCAP31 antibody (Middle Region) (ABIN634582)

Target: BCAP31 (B-Cell Receptor-Associated Protein 31 (BCAP31))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BCAP31 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-BCAP31 Antibody

Binding Specificity: Middle Region

Specificity: BCAP31 antibody was raised against the middle region of BCAP31

Purification: Affinity purified

Immunogen: BCAP31 antibody was raised using the middle region of BCAP31 corresponding to a region with amino acids STKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BCAP31 Blocking Peptide, (ABIN5612289), is also available for use as a blocking control in assays to test for specificity of this BCAP31 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCAP31 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BCAP31

Target: BCAP31 (B-Cell Receptor-Associated Protein 31 (BCAP31))

Alternative Name: BCAP31

Background: BCAP31 is a member of the B-cell receptor associated protein 31 superfamily. It is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in the caspase 8-mediated apoptosis. Microdeletions in this gene are associated with the contiguous ABCD1/DXS1375E deletion syndrome.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity