BCAP31 antibody (Middle Region)
-
- Target See all BCAP31 Antibodies
- BCAP31 (B-Cell Receptor-Associated Protein 31 (BCAP31))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BCAP31 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- BCAP31 antibody was raised against the middle region of BCAP31
- Purification
- Affinity purified
- Immunogen
- BCAP31 antibody was raised using the middle region of BCAP31 corresponding to a region with amino acids STKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE
- Top Product
- Discover our top product BCAP31 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BCAP31 Blocking Peptide, catalog no. 33R-8871, is also available for use as a blocking control in assays to test for specificity of this BCAP31 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCAP31 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BCAP31 (B-Cell Receptor-Associated Protein 31 (BCAP31))
- Alternative Name
- BCAP31 (BCAP31 Products)
- Synonyms
- 6c6-ag antibody, bap31 antibody, cdm antibody, dxs1357e antibody, BCAP31 antibody, Bap31 antibody, 6C6-AG antibody, BAP31 antibody, CDM antibody, DXS1357E antibody, CALD1 antibody, caldesmon antibody, si:bz30i22.4 antibody, si:rp71-30i22.4 antibody, zgc:56389 antibody, B-cell receptor associated protein 31 antibody, receptor-associated protein antibody, lipopeptide mating pheromone precursor bap3-1 antibody, B cell receptor associated protein 31 antibody, B-cell receptor-associated protein 31 antibody, B-cell receptor associated protein 31 L homeolog antibody, bcap31 antibody, BAP31 antibody, bap3-1 antibody, BCAP31 antibody, Bcap31 antibody, bcap31.L antibody
- Background
- BCAP31 is a member of the B-cell receptor associated protein 31 superfamily. It is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in the caspase 8-mediated apoptosis. Microdeletions in this gene are associated with the contiguous ABCD1/DXS1375E deletion syndrome.
- Molecular Weight
- 28 kDa (MW of target protein)
- Pathways
- Positive Regulation of Endopeptidase Activity
-