BAG3 antibody (Middle Region)

Catalog No. ABIN634595

Product Details anti-BAG3 Antibody

Target: BAG3 (BCL2-Associated Athanogene 3 (BAG3))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BAG3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BAG3 antibody was raised against the middle region of BAG3

Purification: Affinity purified

Immunogen: BAG3 antibody was raised using the middle region of BAG3 corresponding to a region with amino acids NVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAAS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BAG3 Blocking Peptide, catalog no. 33R-6927, is also available for use as a blocking control in assays to test for specificity of this BAG3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BAG3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BAG3

Target: BAG3 (BCL2-Associated Athanogene 3 (BAG3))

Alternative Name: BAG3 (BAG3 Products)

Synonyms: bag3-A antibody, MGC53113 antibody, zgc:100859 antibody, BAG3 antibody, ATBAG3 antibody, BCL-2-associated athanogene 3 antibody, T28J14.160 antibody, T28J14_160 antibody, BAG-3 antibody, BIS antibody, CAIR-1 antibody, MFM6 antibody, AA407278 antibody, Bis antibody, mg638 antibody, BCL2 associated athanogene 3 L homeolog antibody, BCL2-associated athanogene 3 antibody, BCL2 associated athanogene 3 antibody, BCL-2-associated athanogene 3 antibody, Bcl2-associated athanogene 3 antibody, bag3.L antibody, bag3 antibody, BAG3 antibody, Bag3 antibody

Background: BAG3 inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release. BAG3 has anti-apoptotic activity.

Molecular Weight: 61 kDa (MW of target protein)