ARMC3 antibody (Middle Region)

Catalog No. ABIN634605

This anti-ARMC3 antibody is a Rabbit Polyclonal antibody detecting ARMC3 in WB. Suitable for Human.

Quick Overview for ARMC3 antibody (Middle Region) (ABIN634605)

Target: ARMC3 (Armadillo Repeat Containing 3 (ARMC3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARMC3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ARMC3 Antibody

Binding Specificity: Middle Region

Specificity: ARMC3 antibody was raised against the middle region of ARMC3

Purification: Affinity purified

Immunogen: ARMC3 antibody was raised using the middle region of ARMC3 corresponding to a region with amino acids YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARMC3 Blocking Peptide, (ABIN936085), is also available for use as a blocking control in assays to test for specificity of this ARMC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARMC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARMC3

Target: ARMC3 (Armadillo Repeat Containing 3 (ARMC3))

Alternative Name: ARMC3

Background: Armadillo/beta-catenin like (ARM) domains are imperfect 45-amino acid repeats involved in protein-protein interactions. ARM domain-containing proteins, such as ARMC3, function in signal transduction, development, cell adhesion and mobility, and tumor initiation and metastasis.

Molecular Weight: 96 kDa (MW of target protein)