ARMC3 antibody (Middle Region)
-
- Target See all ARMC3 Antibodies
- ARMC3 (Armadillo Repeat Containing 3 (ARMC3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ARMC3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ARMC3 antibody was raised against the middle region of ARMC3
- Purification
- Affinity purified
- Immunogen
- ARMC3 antibody was raised using the middle region of ARMC3 corresponding to a region with amino acids YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE
- Top Product
- Discover our top product ARMC3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ARMC3 Blocking Peptide, catalog no. 33R-10121, is also available for use as a blocking control in assays to test for specificity of this ARMC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARMC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ARMC3 (Armadillo Repeat Containing 3 (ARMC3))
- Alternative Name
- ARMC3 (ARMC3 Products)
- Background
- Armadillo/beta-catenin like (ARM) domains are imperfect 45-amino acid repeats involved in protein-protein interactions. ARM domain-containing proteins, such as ARMC3, function in signal transduction, development, cell adhesion and mobility, and tumor initiation and metastasis.
- Molecular Weight
- 96 kDa (MW of target protein)
-