Parvin, beta antibody (C-Term)

Catalog No. ABIN634626

This anti-Parvin, beta antibody is a Rabbit Polyclonal antibody detecting Parvin, beta in WB. Suitable for Human, Mouse and Rat.

Quick Overview for Parvin, beta antibody (C-Term) (ABIN634626)

Target: Parvin, beta (PARVB)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Parvin, beta antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Parvin, beta Antibody

Binding Specificity: C-Term

Specificity: PARVB antibody was raised against the C terminal of PARVB

Purification: Affinity purified

Immunogen: PARVB antibody was raised using the C terminal of PARVB corresponding to a region with amino acids HNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PARVB Blocking Peptide, (ABIN939189), is also available for use as a blocking control in assays to test for specificity of this PARVB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARVB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Parvin, beta

Target: Parvin, beta (PARVB)

Alternative Name: PARVB

Background: Members of the parvin family, including PARVB, are actin-binding proteins associated with focal contacts.Members of the parvin family, including PARVB, are actin-binding proteins associated with focal contacts.

Molecular Weight: 45 kDa (MW of target protein)