ADAM12 antibody
-
- Target See all ADAM12 Antibodies
- ADAM12 (ADAM Metallopeptidase Domain 12 (ADAM12))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ADAM12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ADAM12 antibody was raised using a synthetic peptide corresponding to a region with amino acids VELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVE
- Top Product
- Discover our top product ADAM12 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ADAM12 Blocking Peptide, catalog no. 33R-9503, is also available for use as a blocking control in assays to test for specificity of this ADAM12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADAM12 (ADAM Metallopeptidase Domain 12 (ADAM12))
- Alternative Name
- ADAM12 (ADAM12 Products)
- Synonyms
- ADAM12 antibody, adam12 antibody, Mltna antibody, mKIAA4001 antibody, MCMP antibody, MCMPMltna antibody, MLTN antibody, MLTNA antibody, ADAM metallopeptidase domain 12 antibody, a disintegrin and metallopeptidase domain 12 (meltrin alpha) antibody, ADAM12 antibody, adam12 antibody, Adam12 antibody
- Background
- ADAM12 is a member of the ADAM (a disintegrin and metalloprotease) protein family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis.
- Molecular Weight
- 58 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway
-