ADAM12 antibody

Catalog No. ABIN634632

The Rabbit Polyclonal anti-ADAM12 antibody (ABIN634632) specifically detects ADAM12 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for ADAM12 antibody (ABIN634632)

Target: ADAM12 (ADAM Metallopeptidase Domain 12 (ADAM12))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADAM12 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ADAM12 Antibody

Purification: Affinity purified

Immunogen: ADAM12 antibody was raised using a synthetic peptide corresponding to a region with amino acids VELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADAM12 Blocking Peptide, (ABIN5611931), is also available for use as a blocking control in assays to test for specificity of this ADAM12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADAM12

Target: ADAM12 (ADAM Metallopeptidase Domain 12 (ADAM12))

Alternative Name: ADAM12

Background: ADAM12 is a member of the ADAM (a disintegrin and metalloprotease) protein family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway