ADAMDEC1 antibody (Middle Region)

Catalog No. ABIN634635

Product Details anti-ADAMDEC1 Antibody

Target: ADAMDEC1 (ADAM-Like, Decysin 1 (ADAMDEC1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADAMDEC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ADAMDEC1 antibody was raised against the middle region of ADAMDEC1

Purification: Affinity purified

Immunogen: ADAMDEC1 antibody was raised using the middle region of ADAMDEC1 corresponding to a region with amino acids GMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADAMDEC1 Blocking Peptide, catalog no. 33R-3436, is also available for use as a blocking control in assays to test for specificity of this ADAMDEC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAMDEC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADAMDEC1

Target: ADAMDEC1 (ADAM-Like, Decysin 1 (ADAMDEC1))

Alternative Name: ADAMDEC1 (ADAMDEC1 Products)

Synonyms: ADAMDEC1 antibody, 2210414L24Rik antibody, AI574231 antibody, Dcsn antibody, M12.219 antibody, ADAM-like, decysin 1 antibody, ADAM like decysin 1 antibody, Adamdec1 antibody, ADAMDEC1 antibody

Background: This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation.

Molecular Weight: 53 kDa (MW of target protein)