NID2 antibody
-
- Target See all NID2 Antibodies
- NID2 (Nidogen 2 (NID2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NID2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- NID2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRSQPGTTPACIPTVAPPMV
- Top Product
- Discover our top product NID2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NID2 Blocking Peptide, catalog no. 33R-1881, is also available for use as a blocking control in assays to test for specificity of this NID2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NID2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NID2 (Nidogen 2 (NID2))
- Alternative Name
- NID2 (NID2 Products)
- Synonyms
- AW547149 antibody, Ly111 antibody, NID-2 antibody, entactin-2 antibody, nidogen-2 antibody, nidogen 2 antibody, Nid2 antibody, NID2 antibody
- Background
- Basement membranes, which are composed of type IV collagens, laminins, perlecan, and nidogen, are thin pericellular protein matrices that control a large number of cellular activities, including adhesion, migration, differentiation, gene expression, and apoptosis.
- Molecular Weight
- 148 kDa (MW of target protein)
-