Desmoglein 2 antibody (N-Term)

Catalog No. ABIN634678

This Rabbit Polyclonal antibody specifically detects Desmoglein 2 in WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for Desmoglein 2 antibody (N-Term) (ABIN634678)

Target: Desmoglein 2 (DSG2)

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Desmoglein 2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Desmoglein 2 Antibody

Binding Specificity: N-Term

Specificity: Desmoglein 2 antibody was raised against the N terminal of DSG2

Purification: Affinity purified

Immunogen: Desmoglein 2 antibody was raised using the N terminal of DSG2 corresponding to a region with amino acids KIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Desmoglein 2 Blocking Peptide, (ABIN939816), is also available for use as a blocking control in assays to test for specificity of this Desmoglein 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DSG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Desmoglein 2

Target: Desmoglein 2 (DSG2)

Alternative Name: Desmoglein 2

Background: Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. DSG2 is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines.

Molecular Weight: 114 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization