LSAMP antibody (N-Term)
-
- Target See all LSAMP Antibodies
- LSAMP (Limbic System-Associated Membrane Protein (LSAMP))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LSAMP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LSAMP antibody was raised against the N terminal of LSAMP
- Purification
- Affinity purified
- Immunogen
- LSAMP antibody was raised using the N terminal of LSAMP corresponding to a region with amino acids MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAI
- Top Product
- Discover our top product LSAMP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LSAMP Blocking Peptide, catalog no. 33R-6605, is also available for use as a blocking control in assays to test for specificity of this LSAMP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSAMP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LSAMP (Limbic System-Associated Membrane Protein (LSAMP))
- Alternative Name
- LSAMP (LSAMP Products)
- Synonyms
- chLAMP antibody, IGLON3 antibody, LAMP antibody, 5430428I19 antibody, AW046674 antibody, B130007O04Rik antibody, D930023J12Rik antibody, Lam antibody, Lamp antibody, limbic system-associated membrane protein antibody, LSAMP antibody, Lsamp antibody
- Background
- LSAMP is a neuronal surface glycoprotein found in cortical and subcortical regions of the limbic system. During development of the limbic system, this protein is found on the surface of axonal membranes and growth cones, where it acts as a selective homophilic adhesion molecule, and guides the development of specific patterns of neuronal connections.
- Molecular Weight
- 37 kDa (MW of target protein)
-