Cadherin 8 antibody (Middle Region)

Catalog No. ABIN634700

The Rabbit Polyclonal anti-Cadherin 8 antibody is suitable to detect Cadherin 8 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for Cadherin 8 antibody (Middle Region) (ABIN634700)

Target: Cadherin 8 (CDH8)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cadherin 8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Cadherin 8 Antibody

Binding Specificity: Middle Region

Specificity: CDH8 antibody was raised against the middle region of CDH8

Purification: Affinity purified

Immunogen: CDH8 antibody was raised using the middle region of CDH8 corresponding to a region with amino acids HENAALNSVIGQVTARDPDITSSPIRFSIDRHTDLERQFNINADDGKITL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDH8 Blocking Peptide, (ABIN939107), is also available for use as a blocking control in assays to test for specificity of this CDH8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cadherin 8

Target: Cadherin 8 (CDH8)

Alternative Name: CDH8

Background: CDH8 is a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain.

Molecular Weight: 81 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization