Cadherin 8 antibody (Middle Region)
-
- Target See all Cadherin 8 (CDH8) Antibodies
- Cadherin 8 (CDH8)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Cadherin 8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CDH8 antibody was raised against the middle region of CDH8
- Purification
- Affinity purified
- Immunogen
- CDH8 antibody was raised using the middle region of CDH8 corresponding to a region with amino acids HENAALNSVIGQVTARDPDITSSPIRFSIDRHTDLERQFNINADDGKITL
- Top Product
- Discover our top product CDH8 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CDH8 Blocking Peptide, catalog no. 33R-3721, is also available for use as a blocking control in assays to test for specificity of this CDH8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cadherin 8 (CDH8)
- Alternative Name
- CDH8 (CDH8 Products)
- Synonyms
- AI851472 antibody, cad8 antibody, cadherin-8 antibody, Nbla04261 antibody, cadherin 8 antibody, cadherin 8, type 2 antibody, Cdh8 antibody, CDH8 antibody
- Background
- CDH8 is a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain.
- Molecular Weight
- 81 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-