ADAM2 antibody
-
- Target See all ADAM2 Antibodies
- ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ADAM2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ADAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVIL
- Top Product
- Discover our top product ADAM2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ADAM2 Blocking Peptide, catalog no. 33R-7144, is also available for use as a blocking control in assays to test for specificity of this ADAM2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))
- Alternative Name
- ADAM2 (ADAM2 Products)
- Synonyms
- AI323749 antibody, Ftnb antibody, Ph30-beta antibody, CRYN1 antibody, CRYN2 antibody, CT15 antibody, FTNB antibody, PH-30b antibody, PH30 antibody, PH30-beta antibody, PH-30 antibody, a disintegrin and metallopeptidase domain 2 antibody, ADAM metallopeptidase domain 2 antibody, Adam2 antibody, ADAM2 antibody
- Background
- ADAM2 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM2 is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.
- Molecular Weight
- 81 kDa (MW of target protein)
-