Tetraspanin 2 antibody (Middle Region)

Catalog No. ABIN634704

Product Details anti-Tetraspanin 2 Antibody

Target: Tetraspanin 2 (TSPAN2)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Tetraspanin 2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Tetraspanin 2 antibody was raised against the middle region of TSPAN2

Purification: Affinity purified

Immunogen: Tetraspanin 2 antibody was raised using the middle region of TSPAN2 corresponding to a region with amino acids FAFIGKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tetraspanin 2 Blocking Peptide, catalog no. 33R-2840, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Tetraspanin 2

Target: Tetraspanin 2 (TSPAN2)

Alternative Name: Tetraspanin 2 (TSPAN2 Products)

Synonyms: NET3 antibody, TSN2 antibody, TSPAN-2 antibody, 6330415F13Rik antibody, B230119D02Rik antibody, tspan-2 antibody, Tspan-2 antibody, tetraspanin 2 antibody, TSPAN2 antibody, tspan2 antibody, Tspan2 antibody

Background: TSPAN2 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

Molecular Weight: 24 kDa (MW of target protein)