Cadherin 24 antibody (N-Term)

Catalog No. ABIN634707

This anti-Cadherin 24 antibody is a Rabbit Polyclonal antibody detecting Cadherin 24 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for Cadherin 24 antibody (N-Term) (ABIN634707)

Target: Cadherin 24 (CDH24)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cadherin 24 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Cadherin 24 Antibody

Binding Specificity: N-Term

Specificity: CDH24 antibody was raised against the N terminal of CDH24

Purification: Affinity purified

Immunogen: CDH24 antibody was raised using the N terminal of CDH24 corresponding to a region with amino acids NPPIFPLGPYHATVPEMSNVGTSVIQVTAHDADDPSYGNSAKLVYTVLDG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDH24 Blocking Peptide, (ABIN5612782), is also available for use as a blocking control in assays to test for specificity of this CDH24 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cadherin 24

Target: Cadherin 24 (CDH24)

Alternative Name: CDH24

Background: Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells, cadherins may thus contribute to the sorting of heterogeneous cell types. Cadherin-24 mediate strong cell-cell adhesion.

Molecular Weight: 88 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization