MPZL2 antibody (N-Term)

Catalog No. ABIN634708

This Rabbit Polyclonal antibody specifically detects MPZL2 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for MPZL2 antibody (N-Term) (ABIN634708)

Target: MPZL2 (Myelin Protein Zero-Like 2 (MPZL2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MPZL2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MPZL2 Antibody

Binding Specificity: N-Term

Specificity: MPZL2 antibody was raised against the N terminal of MPZL2

Purification: Affinity purified

Immunogen: MPZL2 antibody was raised using the N terminal of MPZL2 corresponding to a region with amino acids LEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MPZL2 Blocking Peptide, (ABIN940267), is also available for use as a blocking control in assays to test for specificity of this MPZL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPZL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MPZL2

Target: MPZL2 (Myelin Protein Zero-Like 2 (MPZL2))

Alternative Name: MPZL2

Background: Epithelial V-like antigen (EVA) is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. This gene is expressed in the thymus and in several epithelial structures early in embryogenesis.

Molecular Weight: 22 kDa (MW of target protein)