PCDHGC4 antibody (N-Term)
Quick Overview for PCDHGC4 antibody (N-Term) (ABIN634714)
Target
See all PCDHGC4 AntibodiesReactivity
Host
Clonality
Conjugate
Application
-
-
Binding Specificity
- N-Term
-
Specificity
- PCDHGC4 antibody was raised against the N terminal of PCDHGC4
-
Purification
- Affinity purified
-
Immunogen
- PCDHGC4 antibody was raised using the N terminal of PCDHGC4 corresponding to a region with amino acids VKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNPPRSGTAELRVS
-
-
-
-
Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Comment
-
PCDHGC4 Blocking Peptide, (ABIN5615253), is also available for use as a blocking control in assays to test for specificity of this PCDHGC4 antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHGC4 antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Storage
- 4 °C/-20 °C
-
Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- PCDHGC4 (Protocadherin gamma Subfamily C, 4 (PCDHGC4))
-
Alternative Name
- PCDHGC4
-
Background
- PCDHGC4 is a single-pass type I membrane protein. It contains 6 cadherin domains.PCDHGC4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.
-
Molecular Weight
- 98 kDa (MW of target protein)
Target
-