CNTNAP3 antibody (Middle Region)

Catalog No. ABIN634718

The Rabbit Polyclonal anti-CNTNAP3 antibody has been validated for WB. It is suitable to detect CNTNAP3 in samples from Human.

Quick Overview for CNTNAP3 antibody (Middle Region) (ABIN634718)

Target: CNTNAP3 (Contactin Associated Protein-Like 3 (CNTNAP3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CNTNAP3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CNTNAP3 Antibody

Binding Specificity: Middle Region

Specificity: CNTNAP3 antibody was raised against the middle region of CNTNAP3

Purification: Affinity purified

Immunogen: CNTNAP3 antibody was raised using the middle region of CNTNAP3 corresponding to a region with amino acids GSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CNTNAP3 Blocking Peptide, (ABIN938949), is also available for use as a blocking control in assays to test for specificity of this CNTNAP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNTNAP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CNTNAP3

Target: CNTNAP3 (Contactin Associated Protein-Like 3 (CNTNAP3))

Alternative Name: CNTNAP3

Background: The protein encoded by this gene belongs to the NCP family of cell-recognition molecules. This family represents a distinct subgroup of the neurexins. NCP proteins mediate neuron-glial interactions in vertebrates and glial-glial contact in invertebrates.

Molecular Weight: 141 kDa (MW of target protein)