Cadherin-16 antibody (N-Term)

Catalog No. ABIN634728

Product Details anti-Cadherin-16 Antibody

Target: Cadherin-16 (CDH16)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cadherin-16 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CDH16 antibody was raised against the N terminal of CDH16

Purification: Affinity purified

Immunogen: CDH16 antibody was raised using the N terminal of CDH16 corresponding to a region with amino acids SDRDEPGTANSDLRFHILSQAPAQPSPDMFQLEPRLGALALSPKGSTSLD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDH16 Blocking Peptide, catalog no. 33R-8368, is also available for use as a blocking control in assays to test for specificity of this CDH16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cadherin-16

Target: Cadherin-16 (CDH16)

Alternative Name: CDH16 (CDH16 Products)

Synonyms: cadherin 16 antibody, CDH16 antibody, Cdh16 antibody

Background: CDH16 is a member of the cadherin superfamily, which are calcium-dependent, membrane-associated glycoproteins. CDH16 consists of an extracellular domain containing 6 cadherin domains, a transmembrane region and a truncated cytoplasmic domain but lacks the prosequence and tripeptide HAV adhesion recognition sequence typical of most classical cadherins. Expression is exclusively in kidney, where the protein functions as the principal mediator of homotypic cellular recognition, playing a role in the morphogenic direction of tissue development.

Molecular Weight: 88 kDa (MW of target protein)