CNTNAP1 antibody (Contactin Associated Protein 1) (N-Term)

Details for Product anti-CNTNAP1 Antibody No. ABIN634731
Antigen
Epitope
N-Term
15
4
3
2
2
2
1
1
1
1
Reactivity
Human
49
46
35
2
2
2
2
2
2
1
1
Host
Rabbit
47
23
2
1
Clonality
Polyclonal
Conjugate
This CNTNAP1 antibody is un-conjugated
5
3
3
3
3
3
3
3
3
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
40
30
17
16
13
6
2
2
2
1
1
Options
Immunogen CNTNAP1 antibody was raised using the N terminal of CNTNAP1 corresponding to a region with amino acids LQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNS
Specificity CNTNAP1 antibody was raised against the N terminal of CNTNAP1
Purification Affinity purified
Antigen
Alternative Name CNTNAP1 (CNTNAP1 Antibody Abstract)
Background CNTNAP1 was initially identified as a 190 kDa protein associated with the contactin-PTPRZ1 complex. The 1,384-amino acid protein, also designated p190 or CASPR for 'contactin-associated protein,' includes an extracellular domain with several putative protein-protein interaction domains, a putative transmembrane domain, and a 74-amino acid cytoplasmic domain.
Molecular Weight 156 kDa (MW of target protein)
Pathways Cell-Cell Junction Organization
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

CNTNAP1 Blocking Peptide, catalog no. 33R-5315, is also available for use as a blocking control in assays to test for specificity of this CNTNAP1 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNTNAP1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Contactin Associated Protein 1 (CNTNAP1) (N-Term) antibody (ABIN634731) CNTNAP1 antibody used at 1 ug/ml to detect target protein.