SIGLEC6 antibody (N-Term)
-
- Target See all SIGLEC6 Antibodies
- SIGLEC6 (Sialic Acid Binding Ig-Like Lectin 6 (SIGLEC6))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SIGLEC6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SIGLEC6 antibody was raised against the N terminal of SIGLEC6
- Purification
- Affinity purified
- Immunogen
- SIGLEC6 antibody was raised using the N terminal of SIGLEC6 corresponding to a region with amino acids VPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRL
- Top Product
- Discover our top product SIGLEC6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SIGLEC6 Blocking Peptide, catalog no. 33R-9741, is also available for use as a blocking control in assays to test for specificity of this SIGLEC6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SIGLEC6 (Sialic Acid Binding Ig-Like Lectin 6 (SIGLEC6))
- Alternative Name
- SIGLEC6 (SIGLEC6 Products)
- Synonyms
- SIGLEC6 antibody, CD327 antibody, CD33L antibody, CD33L1 antibody, CD33L2 antibody, CDW327 antibody, OBBP1 antibody, sialic acid binding Ig like lectin 6 antibody, SIGLEC6 antibody
- Background
- SIGLEC6 is a Putative adhesion molecule that mediates sialic-acid dependent binding to cells. It binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.
- Molecular Weight
- 47 kDa (MW of target protein)
-