DiGeorge Syndrome Chromosome Region-2 (DGS2) (N-Term) antibody

Details for Product No. ABIN634763
Antigen
Epitope
N-Term
9
8
7
7
3
2
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
31
22
11
4
4
3
2
2
2
2
2
1
Host
Rabbit
32
Clonality
Polyclonal
Conjugate
Un-conjugated
2
2
2
2
2
2
Application
Western Blotting (WB)
31
20
2
1
1
1
Options
Immunogen DGCR2 antibody was raised using the N terminal of DGCR2 corresponding to a region with amino acids MVPKADSGAFLLLFLLVLTVTEPLRPELRCNPGQFACRSGTIQCIPLPWQ
Specificity DGCR2 antibody was raised against the N terminal of DGCR2
Purification Affinity purified
Antigen
Alternative Name DGCR2 (DGS2 Antibody Abstract)
Background DGCR2 is the putative adhesion receptor that could be involved in cell-cell or cell-matrix interactions required for normal cell differentiation and migration.
Molecular Weight 61 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

DGCR2 Blocking Peptide, catalog no. 33R-6598, is also available for use as a blocking control in assays to test for specificity of this DGCR2 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGCR2 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-DiGeorge Syndrome Chromosome Region-2 (DGS2) (N-Term) antibody (ABIN634763) DGCR2 antibody used at 1 ug/ml to detect target protein.