Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

DiGeorge Syndrome Chromosome Region-2 (DGS2) (N-Term) antibody Primary Antibody

DGS2 Reactivity: Human, Mouse, Rat WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN634763
$647.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    DiGeorge Syndrome Chromosome Region-2 (DGS2)
    Binding Specificity
    N-Term
    • 8
    • 8
    • 8
    • 7
    • 3
    • 2
    • 1
    • 1
    Reactivity
    Human, Mouse, Rat
    • 24
    • 16
    • 7
    • 4
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    Host
    Rabbit
    • 24
    Clonality
    Polyclonal
    • 24
    Conjugate
    Un-conjugated
    • 12
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    Application
    Western Blotting (WB)
    • 24
    • 16
    • 1
    • 1
    • 1
    Specificity
    DGCR2 antibody was raised against the N terminal of DGCR2
    Purification
    Affinity purified
    Immunogen
    DGCR2 antibody was raised using the N terminal of DGCR2 corresponding to a region with amino acids MVPKADSGAFLLLFLLVLTVTEPLRPELRCNPGQFACRSGTIQCIPLPWQ
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    DGCR2 Blocking Peptide, catalog no. 33R-6598, is also available for use as a blocking control in assays to test for specificity of this DGCR2 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGCR2 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    DiGeorge Syndrome Chromosome Region-2 (DGS2)
    Alternative Name
    DGCR2 (DGS2 Antibody Abstract)
    Synonyms
    DGS-C, IDD, LAN, SEZ-12, CIDD, 9930034O06Rik, Dgsc, Idd, Lan, Sez12, mKIAA0163, zgc:91974, DiGeorge syndrome critical region gene 2, DiGeorge syndrome critical region gene 2 S homeolog, DGCR2, Dgcr2, dgcr2, dgcr2.S
    Background
    DGCR2 is the putative adhesion receptor that could be involved in cell-cell or cell-matrix interactions required for normal cell differentiation and migration.
    Molecular Weight
    61 kDa (MW of target protein)
You are here:
help Support