Thrombopoietin antibody

Catalog No. ABIN634773

Product Details anti-Thrombopoietin Antibody

Target: Thrombopoietin (THPO)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Thrombopoietin antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Thrombopoietin antibody was raised using a synthetic peptide corresponding to a region with amino acids NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Thrombopoietin Blocking Peptide, catalog no. 33R-6770, is also available for use as a blocking control in assays to test for specificity of this Thrombopoietin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THPO antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Thrombopoietin

Target: Thrombopoietin (THPO)

Alternative Name: Thrombopoietin (THPO Products)

Background: Megakaryocytopoiesis is the cellular development process that leads to platelet production. THPO is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. THPO is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene.Megakaryocytopoiesis is the cellular development process that leads to platelet production.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: JAK-STAT Signaling, Hormone Activity