GMFG antibody (Middle Region)

Catalog No. ABIN634779

This anti-GMFG antibody is a Rabbit Polyclonal antibody detecting GMFG in WB. Suitable for Human.

Quick Overview for GMFG antibody (Middle Region) (ABIN634779)

Target: GMFG (Glia Maturation Factor, gamma (GMFG))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GMFG antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GMFG Antibody

Binding Specificity: Middle Region

Specificity: GMF gamma antibody was raised against the middle region of GMFG

Purification: Affinity purified

Immunogen: GMF gamma antibody was raised using the middle region of GMFG corresponding to a region with amino acids KVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GMF gamma Blocking Peptide, (ABIN940087), is also available for use as a blocking control in assays to test for specificity of this GMF gamma antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GMFG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GMFG

Target: GMFG (Glia Maturation Factor, gamma (GMFG))

Alternative Name: GMF gamma

Background: The function of GMF gamma protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 17 kDa (MW of target protein)