TFF1 antibody (Middle Region)

Catalog No. ABIN634784

The Rabbit Polyclonal anti-TFF1 antibody is suitable to detect TFF1 in samples from Human. It has been validated for WB.

Quick Overview for TFF1 antibody (Middle Region) (ABIN634784)

Target: TFF1 (Trefoil Factor 1 (TFF1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TFF1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TFF1 Antibody

Binding Specificity: Middle Region

Specificity: TFF1 antibody was raised against the middle region of TFF1

Purification: Affinity purified

Immunogen: TFF1 antibody was raised using the middle region of TFF1 corresponding to a region with amino acids PRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TFF1 Blocking Peptide, (ABIN5616568), is also available for use as a blocking control in assays to test for specificity of this TFF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TFF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TFF1

Target: TFF1 (Trefoil Factor 1 (TFF1))

Alternative Name: TFF1

Background: Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa.

Molecular Weight: 7 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway