TFF1 antibody (Middle Region)

Catalog No. ABIN634784

Product Details anti-TFF1 Antibody

Target: TFF1 (Trefoil Factor 1 (TFF1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TFF1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TFF1 antibody was raised against the middle region of TFF1

Purification: Affinity purified

Immunogen: TFF1 antibody was raised using the middle region of TFF1 corresponding to a region with amino acids PRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TFF1 Blocking Peptide, catalog no. 33R-7321, is also available for use as a blocking control in assays to test for specificity of this TFF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TFF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TFF1

Target: TFF1 (Trefoil Factor 1 (TFF1))

Alternative Name: TFF1 (TFF1 Products)

Synonyms: BCEI antibody, D21S21 antibody, HP1.A antibody, HPS2 antibody, pNR-2 antibody, pS2 antibody, Bcei antibody, PS2 antibody, bcei antibody, d21s21 antibody, hp1.a antibody, hps2 antibody, p1 antibody, p1-a antibody, pnr-2 antibody, ps2 antibody, tff1 antibody, xP1 antibody, xp1-L antibody, xp1 antibody, TFF1 antibody, Ps2 antibody, trefoil factor 1 antibody, trefoil factor 1 S homeolog antibody, trefoil factor 1, gene 2 S homeolog antibody, TFF1 antibody, Tff1 antibody, tff1.S antibody, tff1.2.S antibody, LOC100358238 antibody

Background: Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa.

Molecular Weight: 7 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway