LEFTY1 antibody (N-Term)

Catalog No. ABIN634795

This Rabbit Polyclonal antibody specifically detects LEFTY1 in WB. It exhibits reactivity toward Human.

Quick Overview for LEFTY1 antibody (N-Term) (ABIN634795)

Target: LEFTY1 (Left-Right Determination Factor 1 (LEFTY1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LEFTY1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LEFTY1 Antibody

Binding Specificity: N-Term

Specificity: LEFTY1 antibody was raised against the N terminal of LEFTY1

Purification: Affinity purified

Immunogen: LEFTY1 antibody was raised using the N terminal of LEFTY1 corresponding to a region with amino acids MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LEFTY1 Blocking Peptide, (ABIN5614438), is also available for use as a blocking control in assays to test for specificity of this LEFTY1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEFTY1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LEFTY1

Target: LEFTY1 (Left-Right Determination Factor 1 (LEFTY1))

Alternative Name: LEFTY1

Background: LEFTY1 is a member of the TGF-beta family of proteins. A similar secreted protein in mouse plays a role in left-right asymmetry determination of organ systems during development.

Molecular Weight: 11 kDa (MW of target protein)