ABCC9 antibody

Catalog No. ABIN634823

The Rabbit Polyclonal anti-ABCC9 antibody has been validated for WB. It is suitable to detect ABCC9 in samples from Mouse, Human and Rat.

Quick Overview for ABCC9 antibody (ABIN634823)

Target: ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))

Reactivity: Mouse, Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCC9 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ABCC9 Antibody

Purification: Affinity purified

Immunogen: ABCC9 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABCC9 Blocking Peptide, (ABIN937006), is also available for use as a blocking control in assays to test for specificity of this ABCC9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABCC9

Target: ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))

Alternative Name: ABCC9

Background: ABCC9 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle.

Molecular Weight: 174 kDa (MW of target protein)