CTDNEP1A antibody

Catalog No. ABIN634833

This anti-CTDNEP1A antibody is a Rabbit Polyclonal antibody detecting CTDNEP1A in WB. Suitable for Human, Mouse and Rat.

Quick Overview for CTDNEP1A antibody (ABIN634833)

Target: CTDNEP1A (CTD Nuclear Envelope Phosphatase 1a (CTDNEP1A))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CTDNEP1A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CTDNEP1A Antibody

Purification: Affinity purified

Immunogen: DULLARD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DULLARD Blocking Peptide, (ABIN939193), is also available for use as a blocking control in assays to test for specificity of this DULLARD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DULLARD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CTDNEP1A

Target: CTDNEP1A (CTD Nuclear Envelope Phosphatase 1a (CTDNEP1A))

Alternative Name: DULLARD

Background: DULLARD is a serine/threonine phosphatase which may be required for proper nuclear membrane morphology. DULLARD was involved in LPIN1 dephosphorylation. It may antagonize BMP signaling.

Molecular Weight: 28 kDa (MW of target protein)