Seladin 1 antibody (N-Term)

Catalog No. ABIN634838

The Rabbit Polyclonal anti-Seladin 1 antibody has been validated for WB. It is suitable to detect Seladin 1 in samples from Human, Mouse and Rat.

Quick Overview for Seladin 1 antibody (N-Term) (ABIN634838)

Target: Seladin 1 (DHCR24) (24-Dehydrocholesterol Reductase (DHCR24))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Seladin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Seladin 1 Antibody

Binding Specificity: N-Term

Specificity: DHCR24 antibody was raised against the N terminal of DHCR24

Purification: Affinity purified

Immunogen: DHCR24 antibody was raised using the N terminal of DHCR24 corresponding to a region with amino acids FLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQRVRDIQKQVREWKEQGSK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DHCR24 Blocking Peptide, (ABIN938356), is also available for use as a blocking control in assays to test for specificity of this DHCR24 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHCR24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Seladin 1

Target: Seladin 1 (DHCR24) (24-Dehydrocholesterol Reductase (DHCR24))

Alternative Name: DHCR24

Background: DHCR24 is a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis. The protein contains a leader sequence that directs it to the endoplasmic reticulum membrane. Missense mutations in this gene have been associated with desmosterolosis. Also, reduced expression of the gene occurs in the temporal cortex of Alzheimer disease patients and overexpression has been observed in adrenal gland cancer cells.

Molecular Weight: 58 kDa (MW of target protein)