Arylsulfatase H antibody (Middle Region)

Catalog No. ABIN634839

This anti-Arylsulfatase H antibody is a Rabbit Polyclonal antibody detecting Arylsulfatase H in WB. Suitable for Human.

Quick Overview for Arylsulfatase H antibody (Middle Region) (ABIN634839)

Target: Arylsulfatase H (ARSH)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Arylsulfatase H antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Arylsulfatase H Antibody

Binding Specificity: Middle Region

Specificity: ARSH antibody was raised against the middle region of ARSH

Purification: Affinity purified

Immunogen: ARSH antibody was raised using the middle region of ARSH corresponding to a region with amino acids FIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKYGRYGDNVEEMDWMVG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARSH Blocking Peptide, (ABIN938310), is also available for use as a blocking control in assays to test for specificity of this ARSH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARSH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Arylsulfatase H

Target: Arylsulfatase H (ARSH)

Alternative Name: ARSH

Background: Sulfatases, such as ARSH, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules.

Molecular Weight: 63 kDa (MW of target protein)