ABCE1 antibody

Catalog No. ABIN634841

The Rabbit Polyclonal anti-ABCE1 antibody is suitable to detect ABCE1 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for ABCE1 antibody (ABIN634841)

Target: ABCE1 (ATP-Binding Cassette, Sub-Family E (OABP), Member 1 (ABCE1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCE1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ABCE1 Antibody

Purification: Affinity purified

Immunogen: ABCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABCE1 Blocking Peptide, (ABIN940156), is also available for use as a blocking control in assays to test for specificity of this ABCE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABCE1

Target: ABCE1 (ATP-Binding Cassette, Sub-Family E (OABP), Member 1 (ABCE1))

Alternative Name: ABCE1

Background: ABCE1 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the OABP subfamily. Alternatively referred to as the RNase L inhibitor, this protein functions to block the activity of ribonuclease L. Activation of ribonuclease L leads to inhibition of protein synthesis in the 2-5A/RNase L system, the central pathway for viral interferon action.

Molecular Weight: 67 kDa (MW of target protein)